| Edit |   |
| Antigenic Specificity | CDRT4 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The CDRT4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CDRT4. This antibody reacts with human. The CDRT4 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to CDRT4(CMT1A duplicated region transcript 4) The peptide sequence was selected from the middle region of CDRT4. Peptide sequence TSQTVKRLIEKSKTRELECMRALEERPWASRQNKPSSVIQPKRRKSSKSS. |
| Other Names | CMT1A duplicated region transcript 4, CMT1A duplicated region transcript 4 protein, FLJ36674, MGC33988, NBLA10383, putative protein product of Nbla10383 |
| Gene, Accession # | CDRT4, Gene ID: 284040, Accession: Q8N9R6, SwissProt: Q8N9R6 |
| Catalog # | NBP1-55440-20ul |
| Price | |
| Order / More Info | CDRT4 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |