| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | CDS2 |
|---|
| Clone | 2B9 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG1 kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CDS2 Antibody (2B9) from Novus Biologicals is a mouse monoclonal antibody to CDS2. This antibody reacts with human. The CDS2 Antibody (2B9) has been validated for the following applications: Western Blot, ELISA. |
|---|
| Immunogen | CDS2 (NP_003809, 1 a.a. - 67 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MTELRQRVAHEPVAPPEDKESESEAKVDGETASDSESRAESAPLPVSADDTPEVLNRALSNLSSRWK |
|---|
| Other Names | CDP-DAG synthase 2, CDP-DG synthase 2, CDP-DG synthetase 2, CDP-diacylglycerol synthase (phosphatidate cytidylyltransferase) 2, CDP-diacylglycerol synthase 2, CDP-diglyceride diphosphorylase 2, CDP-diglyceride pyrophosphorylase 2, CDP-diglyceride synthase 2, CDP-diglyceride synthetase 2, CDS 2, CTP:phosphatidate cytidylyltransferase 2, EC 2.7.7, EC 2.7.7.41, FLJ38111, phosphatidate cytidylyltransferase 2 |
|---|
| Gene, Accession # | CDS2, Gene ID: 8760, Accession: NP_003809, SwissProt: NP_003809 |
|---|
| Catalog # | H00008760-M01 |
|---|
| Price | |
|---|
| Order / More Info | CDS2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|