| Edit |   |
|---|
| Antigenic Specificity | BMP-10 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The BMP-10 Antibody from Novus Biologicals is a rabbit polyclonal antibody to BMP-10. This antibody reacts with rat. The BMP-10 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to Bmp10 (bone morphogenetic protein 10) The peptide sequence was selected from the N terminal of Bmp10. Peptide sequence KFATDRTSMPSANIIRSFKNEDLFSQPVSFNGIRKYPLLFNVSIPHHEEV. |
|---|
| Other Names | BMP-10, bone morphogenetic protein 10, MGC126783 |
|---|
| Gene, Accession # | BMP10, Gene ID: 27302 |
|---|
| Catalog # | NBP1-69112-20ul |
|---|
| Price | |
|---|
| Order / More Info | BMP-10 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|