| Edit |   |
| Antigenic Specificity | BMP-10 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The BMP-10 Antibody from Novus Biologicals is a rabbit polyclonal antibody to BMP-10. This antibody reacts with rat. The BMP-10 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to Bmp10 (bone morphogenetic protein 10) The peptide sequence was selected from the N terminal of Bmp10. Peptide sequence KFATDRTSMPSANIIRSFKNEDLFSQPVSFNGIRKYPLLFNVSIPHHEEV. |
| Other Names | BMP-10, bone morphogenetic protein 10, MGC126783 |
| Gene, Accession # | BMP10, Gene ID: 27302 |
| Catalog # | NBP1-69112 |
| Price | |
| Order / More Info | BMP-10 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |