| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | MED18 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The MED18 Antibody from Novus Biologicals is a rabbit polyclonal antibody to MED18. This antibody reacts with human. The MED18 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human MED18 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: RARRSMDRAGAPWHLRYLGQPEMGDKNRHALVRNCVDIATSENLTDFLMEMGFRMDHEFVAKGH |
|---|
| Other Names | FLJ20045, mediator complex subunit 18mediator of RNA polymerase II transcription subunit 18, mediator of RNA polymerase II transcription, subunit 18 homolog (S. cerevisiae), p28bmediator of RNA polymerase II transcription, subunit 18 homolog, TRAP/mediator complex subunit p28b |
|---|
| Gene, Accession # | MED18, Gene ID: 54797 |
|---|
| Catalog # | NBP1-83673 |
|---|
| Price | |
|---|
| Order / More Info | MED18 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|