| 产品详情 |
| Edit |   |
| Antigenic Specificity | ISG15 Activating Enzyme/UBE1L |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The ISG15 Activating Enzyme/UBE1L Antibody from Novus Biologicals is a rabbit polyclonal antibody to ISG15 Activating Enzyme/UBE1L. This antibody reacts with human. The ISG15 Activating Enzyme/UBE1L Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human ISG15 Activating Enzyme/UBE1L antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: EVKRPKTVRHKSLDTALLQPHVVAQSSQEVHHAHCLHQAFCALHKFQHLHGRPPQPWDPVDAETVVGLARDLEPLKR |
| Other Names | D8UBA1, ubiquitin-activating enzyme E1 homolog B, UBA1B, UBA7, ubiquitin-activating enzyme E1, UBE1L, UBE2MGC12713, Ubiquitin-activating enzyme 7, Ubiquitin-activating enzyme E1 homolog, ubiquitin-activating enzyme E1-like, ubiquitin-activating enzyme E1-related protein, ubiquitin-activating enzyme-2, ubiquitin-like modifier activating enzyme 7, ubiquitin-like modifier-activating enzyme 7 |
| Gene, Accession # | UBA7, Gene ID: 7318 |
| Catalog # | NBP2-55032 |
| Price | |
| Order / More Info | ISG15 Activating Enzyme/UBE1L Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|