| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | FUT10 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The FUT10 Antibody from Novus Biologicals is a rabbit polyclonal antibody to FUT10. This antibody reacts with human. The FUT10 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human FUT10 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: LGKFERKEFKSSSLQDGHTKMEEAPTHLNSFLKKEGLTFNRKRKWELDSYPIMLWWSPLTGETGRLGQCGADACFFTINRTYLHHH |
|---|
| Other Names | alpha 1,3-fucosyl transferase, alpha-(1,3)-fucosyltransferase 10, EC 2.4.1, EC 2.4.1.-, Fucosyltransferase 10, fucosyltransferase 10 (alpha (1,3) fucosyltransferase), Fucosyltransferase X, Fuc-TX, FucT-X, Galactoside 3-L-fucosyltransferase 10, MGC11141 |
|---|
| Gene, Accession # | FUT10, Gene ID: 84750, Accession: Q6P4F1, SwissProt: Q6P4F1 |
|---|
| Catalog # | NBP2-31571 |
|---|
| Price | |
|---|
| Order / More Info | FUT10 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|