| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | FUT9 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The FUT9 Antibody from Novus Biologicals is a rabbit polyclonal antibody to FUT9. This antibody reacts with human. The FUT9 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human FUT9 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ADSFIHVEDYNSPSELAKYLKEVDKNNKLYLSYFNWRKDFTVNLPRFWESHACLACDHVKRHQEYKSVGNLEKWF |
|---|
| Other Names | alpha-(1,3)-fucosyltransferase, EC 2.4.1, EC 2.4.1.-, EC 2.4.1.65, Fucosyltransferase 9, fucosyltransferase 9 (alpha (1,3) fucosyltransferase), Fucosyltransferase IX, fucT-IX, Fuc-TIXFucT-IX, Galactoside 3-L-fucosyltransferase |
|---|
| Gene, Accession # | FUT9, Gene ID: 10690 |
|---|
| Catalog # | NBP2-57960 |
|---|
| Price | |
|---|
| Order / More Info | FUT9 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|