| Edit |   |
|---|
| Antigenic Specificity | PXT1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PXT1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PXT1. This antibody reacts with human. The PXT1 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to PXT1(peroxisomal, testis specific 1) The peptide sequence was selected from the middle region of PXT1. Peptide sequence MQLRHIGDNIDHRMVREDLQQDGRDALDHFVFFFFRRVQVLLHFFWNNHL. |
|---|
| Other Names | peroxisomal, testis specific 1 |
|---|
| Gene, Accession # | PXT1, Gene ID: 222659 |
|---|
| Catalog # | NBP1-70693-20ul |
|---|
| Price | |
|---|
| Order / More Info | PXT1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|