| Edit |   |
|---|
| Antigenic Specificity | LRRC6 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The LRRC6 Antibody from Novus Biologicals is a rabbit polyclonal antibody to LRRC6. This antibody reacts with human. The LRRC6 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to LRRC6(leucine rich repeat containing 6) The peptide sequence was selected from the middle region of LRRC6. Peptide sequence MKTTSDRSREQTNTRSKHMEKLEVDPSKHSFPDVTNIVQEKKHTPRRRPE. |
|---|
| Other Names | leucine rich repeat containing 6, Leucine-rich testis-specific protein, LRTPleucine-rich repeat-containing protein 6, Testis-specific leucine-rich repeat protein, TSLRPtestis specific leucine rich repeat protein |
|---|
| Gene, Accession # | LRRC6, Gene ID: 23639, Accession: Q86X45, SwissProt: Q86X45 |
|---|
| Catalog # | NBP1-53157-20ul |
|---|
| Price | |
|---|
| Order / More Info | LRRC6 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|