| Edit |   |
| Antigenic Specificity | LRRC37A |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The LRRC37A Antibody from Novus Biologicals is a rabbit polyclonal antibody to LRRC37A. This antibody reacts with human. The LRRC37A Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human LRRC37A2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: EQFLASQQDLKDKLSPQERLPVSPKKLKKDPAQRWS |
| Other Names | Leucine Rich Repeat Containing 37A, Leucine-Rich Repeat-Containing Protein 37A, LRRC37, LRRC37A1 |
| Gene, Accession # | LRRC37A, Gene ID: 9884, Accession: O60309 |
| Catalog # | NBP2-46666 |
| Price | |
| Order / More Info | LRRC37A Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |