| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Kir6.2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Kir6.2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Kir6.2. This antibody reacts with human. The Kir6.2 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human Kir6 |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: TVKVPTPLCTARQLDEDHSLLEALTLASARGPLRKRSVPMAKAKPKFSISPDSLS |
|---|
| Other Names | ATP-sensitive inward rectifier potassium channel 11, beta-cell inward rectifier subunit, BIRKIR6.2, HHF2, IKATP, Inward rectifier K(+) channel Kir6.2, inwardly rectifying potassium channel KIR6.2, Kir6.2, MGC133230, PHHI, potassium channel inwardly rectifing subfamily J member 11, Potassium channel, inwardly rectifying subfamily J member 11, potassium inwardly-rectifying channel, subfamily J, member 11, TNDM3 |
|---|
| Gene, Accession # | KCNJ11, Gene ID: 3767, Accession: Q14654, SwissProt: Q14654 |
|---|
| Catalog # | NBP2-33540 |
|---|
| Price | |
|---|
| Order / More Info | Kir6.2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|