| Edit |   |
|---|
| Antigenic Specificity | NIPA2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The NIPA2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to NIPA2. This antibody reacts with human. The NIPA2 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry. |
|---|
| Immunogen | Synthetic peptide directed towards the middle region of human NIPA2. Peptide sequence VYITICSVIGAFSVSCVKGLGIAIKELFAGKPVLRHPLAWILLLSLIVCV. |
|---|
| Other Names | magnesium transporter NIPA2, MGC5466, non imprinted in Prader-Willi/Angelman syndrome 2 |
|---|
| Gene, Accession # | NIPA2, Gene ID: 81614, Accession: NP_001008860, SwissProt: NP_001008860 |
|---|
| Catalog # | NBP1-91580-20ul |
|---|
| Price | |
|---|
| Order / More Info | NIPA2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|