| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | NIPP1 |
|---|
| Clone | 4B5 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA, Immunoprecipitation. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The NIPP1 Antibody (4B5) from Novus Biologicals is a mouse monoclonal antibody to NIPP1. This antibody reacts with human. The NIPP1 Antibody (4B5) has been validated for the following applications: Western Blot, ELISA, Immunoprecipitation. |
|---|
| Immunogen | PPP1R8 (NP_002704.1, 28 a.a. - 127 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RRMQNFAFSGGLYGGLPPTHSEAGSQPHGIHGTALIGGLPMPYPNLAPDVDLTPVVPSAVNMNPAPNPAVYNPEAVNEPKKKKYAKEAWPGKKPTPSLLI |
|---|
| Other Names | activator of RNA decay, ard-1, ARD1nuclear inhibitor of protein phosphatase 1, NIPP1nuclear inhibitor of protein phosphatase-1, NIPP-1nuclear subunit of PP-1, PRO2047, Protein phosphatase 1 regulatory inhibitor subunit 8, protein phosphatase 1 regulatory subunit 8, protein phosphatase 1, regulatory (inhibitor) subunit 8, RNase E |
|---|
| Gene, Accession # | PPP1R8, Gene ID: 5511, Accession: NP_002704, SwissProt: NP_002704 |
|---|
| Catalog # | H00005511-M05 |
|---|
| Price | |
|---|
| Order / More Info | NIPP1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|