| Edit |   |
|---|
| Antigenic Specificity | PGLS |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PGLS Antibody from Novus Biologicals is a rabbit polyclonal antibody to PGLS. This antibody reacts with human. The PGLS Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | Synthetic peptides corresponding to PGLS(6-phosphogluconolactonase) The peptide sequence was selected from the middle region of PGLS. Peptide sequence AAVLKRILEDQEENPLPAALVQPHTGKLCWFLDEAAARLLTVPFEKHSTL. |
|---|
| Other Names | 6PGLEC 3.1.1.31, 6-phosphogluconolactonase |
|---|
| Gene, Accession # | PGLS, Gene ID: 25796, Accession: O95336, SwissProt: O95336 |
|---|
| Catalog # | NBP1-56387-20ul |
|---|
| Price | |
|---|
| Order / More Info | PGLS Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|