| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PGLYRP1/PGRP-S |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. HIER pH6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PGLYRP1/PGRP-S Antibody from Novus Biologicals is a rabbit polyclonal antibody to PGLYRP1/PGRP-S. This antibody reacts with human. The PGLYRP1/PGRP-S Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human PGLYRP1/PGRP-S antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: PMSIGISFMGNYMDRVPTPQAIRAAQGLLACGVAQGALRSNYVLKGHRDVQRTLSPGNQLYHLIQN |
|---|
| Other Names | peptidoglycan recognition protein 1, Peptidoglycan recognition protein short, PGLYRP, PGRPpeptidoglycan recognition protein, PGRP-SMGC126894, PGRPSMGC126896, TAG7, TNF superfamily, member 3 (LTB)-like (peptidoglycan recognition protein), TNFSF3L |
|---|
| Gene, Accession # | PGLYRP1, Gene ID: 8993, Accession: O75594, SwissProt: O75594 |
|---|
| Catalog # | NBP1-92261 |
|---|
| Price | |
|---|
| Order / More Info | PGLYRP1/PGRP-S Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|