| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | EPB41 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The EPB41 Antibody from Novus Biologicals is a rabbit polyclonal antibody to EPB41. This antibody reacts with human. The EPB41 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human EPB41 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: PAPHFERTASKRASRSLDGAAAVDSADRSPRPTSAPAITQGQVAEGGVLDASAKKTVVPKAQKETVKAEVKKEDEPPEQAEPEPTEAWKVE |
|---|
| Other Names | 4.1RBand 4.1, E41P, EL1, EPB4.1, erythrocyte membrane protein band 4.1 (elliptocytosis 1, RH-linked), erythrocyte surface protein band 4.1, HE, P4.1, protein 4.1 |
|---|
| Gene, Accession # | EPB41, Gene ID: 2035 |
|---|
| Catalog # | NBP1-89371 |
|---|
| Price | |
|---|
| Order / More Info | EPB41 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|