| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | EPB42 |
|---|
| Clone | 2G12 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA, Immunocytochemistry/Immunofluorescence. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The EPB42 Antibody (2G12) from Novus Biologicals is a mouse monoclonal antibody to EPB42. This antibody reacts with human. The EPB42 Antibody (2G12) has been validated for the following applications: Western Blot, ELISA, Immunocytochemistry/Immunofluorescence. |
|---|
| Immunogen | EPB42 (NP_000110.1 623 a.a. - 721 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KMPEKAEQYQPLTASVSLQNSLDAPMEDCVISILGRGLIHRERSYRFRSVWPENTMCAKFQFTPTHVGLQRLTVEVDCNMFQNLTNYKSVTVVAPELSA |
|---|
| Other Names | E42P, erythrocyte membrane protein band 4.2, Erythrocyte protein 4.2, erythrocyte surface protein band 4.2, MGC116735, MGC116737, P4.2, PA, SPH5 |
|---|
| Gene, Accession # | EPB42, Gene ID: 2038, Accession: NP_000110, SwissProt: NP_000110 |
|---|
| Catalog # | H00002038-M01 |
|---|
| Price | |
|---|
| Order / More Info | EPB42 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|