| 产品详情 |
| Edit |   |
| Antigenic Specificity | SCAF11/SFRS2IP |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The SCAF11/SFRS2IP Antibody from Novus Biologicals is a rabbit polyclonal antibody to SCAF11/SFRS2IP. This antibody reacts with human. The SCAF11/SFRS2IP Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human SCAF11/SFRS2IP antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SFKFVEQQSYKRKSEQEFSFDTPADRSGWTSASSWAVRKTLPADVQNYYSRRGRNSSGPQSGWMKQEEETSGQDSSLKDQTNQ |
| Other Names | CASP11Splicing regulatory protein 129, Renal carcinoma antigen NY-REN-40, serine/arginine-rich splicing factor 2, interacting protein, Serine/arginine-rich splicing factor 2-interacting protein, SFRS2-interacting protein, SFRS2IPSC35-interacting protein 1, SIP1SRSF2IP, splicing factor, arginine/serine-rich 2, interacting protein, Splicing factor, arginine/serine-rich 2-interacting protein, SR-related and CTD-associated factor 11, SR-related CTD-associated factor 11, SRrp129, SRRP129CTD-associated SR protein 11, SRSF2-interacting protein |
| Gene, Accession # | SCAF11, Gene ID: 9169 |
| Catalog # | NBP2-55306 |
| Price | |
| Order / More Info | SCAF11/SFRS2IP Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|