| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | GOLPH3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. IHC reported in scientific literature (PMID: 23172368). For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The GOLPH3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to GOLPH3. This antibody reacts with human. The GOLPH3 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human GOLPH3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: HASDVLENAFAPLLDEQYDLATKRVRQLLDLDPEVECLKANTNEVLWAVVAAFTK |
|---|
| Other Names | Coat protein GPP34, FLJ90675, Golgi phosphoprotein 3, golgi phosphoprotein 3 (coat-protein), golgi protein, golgi-associated protein, GOPP1, GPP34coat-protein, MIDASgolgi peripheral membrane protein 1, 34 kDa, Mitochondrial DNA absence factor |
|---|
| Gene, Accession # | GOLPH3, Gene ID: 64083 |
|---|
| Catalog # | NBP1-81804 |
|---|
| Price | |
|---|
| Order / More Info | GOLPH3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 23172368 |
|---|
| 产品资料 |
|
|