| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Chymase/CMA1/Mast Cell Chymase |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Use in ICC/IF reported in scientific literature (PMID : 29164232). |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Chymase/CMA1/Mast Cell Chymase Antibody from Novus Biologicals is a rabbit polyclonal antibody to Chymase/CMA1/Mast Cell Chymase. This antibody reacts with human. The Chymase/CMA1/Mast Cell Chymase Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human Chymase/CMA1/Mast Cell Chymase antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: GRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDS |
|---|
| Other Names | Alpha-chymase, chymase, chymase 1 preproprotein transcript E, chymase 1 preproprotein transcript I, chymase 1, mast cell, chymase, heart, chymase, mast cell, CYH, CYM, EC 3.4.21, EC 3.4.21.39, Mast cell protease I, MCT1, MGC119890, MGC119891 |
|---|
| Gene, Accession # | CMA1, Gene ID: 1215, Accession: P23946, SwissProt: P23946 |
|---|
| Catalog # | NBP2-33660 |
|---|
| Price | |
|---|
| Order / More Info | Chymase/CMA1/Mast Cell Chymase Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 29164232 |
|---|
| 产品资料 |
|
|