| Edit |   |
| Antigenic Specificity | Homez |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Homez Antibody from Novus Biologicals is a rabbit polyclonal antibody to Homez. This antibody reacts with human. The Homez Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptide directed towards the N terminal of human HOMEZThe immunogen for this antibody is HOMEZ. Peptide sequence KTFSYFPYPSLADIALLCLRYGLQMEKVKTWFMAQRLRCGISWSSEEIEE. |
| Other Names | homeobox and leucine zipper encoding, homeobox and leucine zipper protein Homez, KIAA1443Homeodomain leucine zipper-containing factor |
| Gene, Accession # | HOMEZ, Gene ID: 57594, Accession: NP_065885, SwissProt: NP_065885 |
| Catalog # | NBP1-79253-20ul |
| Price | |
| Order / More Info | Homez Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |