| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | KLF6 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The KLF6 Antibody from Novus Biologicals is a rabbit polyclonal antibody to KLF6. This antibody reacts with human. The KLF6 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human KLF6 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SSPELSREPSQLWGCVPGELPSPGKVRSGTSGKPGDKGNGDASPDGRRRVHRCHFN |
|---|
| Other Names | BCD1Zf9, B-cell-derived protein 1, COPEBCBA1, core promoter element binding protein, Core promoter element-binding protein, CPBPZF9, DKFZp686N0199, EC 2.1.1.43, EC 6.1.1.15, GBF, GC-rich binding factor, GC-rich sites-binding factor GBF, Krueppel-like factor 6, Kruppel-like factor 6, Kruppel-like zinc finger protein Zf9, PAC1, Proto-oncogene BCD1, protooncogene B-cell derived 1, ST12, suppression of tumorigenicity 12 (prostate), Suppressor of tumorigenicity 12 protein, Transcription factor Zf9 |
|---|
| Gene, Accession # | KLF6, Gene ID: 1316 |
|---|
| Catalog # | NBP2-57355 |
|---|
| Price | |
|---|
| Order / More Info | KLF6 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|