| Edit |   |
|---|
| Antigenic Specificity | KLF9 |
|---|
| Clone | 2B9 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | ELISA. Antibody reactivity against recombinant protein on ELISA. GST alone used as a negative control. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The KLF9 Antibody (2B9) from Novus Biologicals is a mouse monoclonal antibody to KLF9. This antibody reacts with human. The KLF9 Antibody (2B9) has been validated for the following applications: ELISA. |
|---|
| Immunogen | KLF9 (NP_001197, 25 a.a. - 101 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PEHGVAPDAERLRLPEREVTKEHGDPGDTWKDYCTLVTIAKSLLDLNKYRPIQTPSVCSDSLESPDEDMGSDSDVTT |
|---|
| Other Names | basic transcription element binding protein 1, Basic transcription element-binding protein 1, BTEB1GC-box-binding protein 1, BTEBBTE-binding protein 1, Krueppel-like factor 9, Kruppel-like factor 9, Transcription factor BTEB1 |
|---|
| Gene, Accession # | KLF9, Gene ID: 687, Accession: NP_001197, SwissProt: NP_001197 |
|---|
| Catalog # | H00000687-M02 |
|---|
| Price | |
|---|
| Order / More Info | KLF9 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|