| Edit |   |
|---|
| Antigenic Specificity | SLC26A4 |
|---|
| Clone | 3D2 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | ELISA. Antibody reactivity against recombinant protein on ELISA. GST alone used as a negative control. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SLC26A4 Antibody (3D2) from Novus Biologicals is a mouse monoclonal antibody to SLC26A4. This antibody reacts with human. The SLC26A4 Antibody (3D2) has been validated for the following applications: ELISA. |
|---|
| Immunogen | SLC26A4 (NP_000432 674 a.a. - 754 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RSLRVIVKEFQRIDVNVYFASLQDYVIEKLEQCGFFDDNIRKDTFFLTVHDAILYLQNQVKSQEGQGSILETITLIQDCKD |
|---|
| Other Names | DFNB4, EVA, PDSTDH2B, pendrin, Sodium-independent chloride/iodide transporter, Solute carrier family 26 member 4, solute carrier family 26, member 4 |
|---|
| Gene, Accession # | SLC26A4, Gene ID: 5172, Accession: NP_000432, SwissProt: NP_000432 |
|---|
| Catalog # | H00005172-M03 |
|---|
| Price | |
|---|
| Order / More Info | SLC26A4 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|