| Edit |   |
|---|
| Antigenic Specificity | SLC26A9 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SLC26A9 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SLC26A9. This antibody reacts with human. The SLC26A9 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human SLC26A9 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: MSQPRPRYVVDRAAYSLTLFDDEFEKKDRTYPVGEKLRNAFRC |
|---|
| Other Names | Anion transporter/exchanger protein 9, anion transporter/exchanger-9, solute carrier family 26 member 9, solute carrier family 26, member 9 |
|---|
| Gene, Accession # | SLC26A9, Gene ID: 115019, Accession: Q7LBE3, SwissProt: Q7LBE3 |
|---|
| Catalog # | NBP2-30425 |
|---|
| Price | |
|---|
| Order / More Info | SLC26A9 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|