| Edit |   |
| Antigenic Specificity | SLC26A9 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The SLC26A9 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SLC26A9. This antibody reacts with human. The SLC26A9 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to SLC26A9(solute carrier family 26, member 9) The peptide sequence was selected from the middle region of SLC26A9. Peptide sequence LAKLSSTYGKIGVKVFLVNIHAQVYNDISHGGVFEDGSLECKHVFPSIHD. |
| Other Names | Anion transporter/exchanger protein 9, anion transporter/exchanger-9, solute carrier family 26 member 9, solute carrier family 26, member 9 |
| Gene, Accession # | SLC26A9, Gene ID: 115019, Accession: Q7LBE3, SwissProt: Q7LBE3 |
| Catalog # | NBP1-59514 |
| Price | |
| Order / More Info | SLC26A9 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |