| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | SLC28A2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SLC28A2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SLC28A2. This antibody reacts with human. The SLC28A2 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human SLC28A2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: GAEADCVSFPNTSFTNRTYETYMCCRGLFQSTSLNGTNPPSFSGPWEDKEFSAMALTNCCGFYNNTVCA |
|---|
| Other Names | CNT2SPNT, Concentrative nucleoside transporter 2, FLJ21468, HCNT2, HsT17153, MGC138252, Na(+)/nucleoside cotransporter 2, sodium/nucleoside cotransporter 2, Sodium/purine nucleoside co-transporter, Sodium-coupled nucleoside transporter 2, solute carrier family 28 (sodium-coupled nucleoside transporter), member 2, Solute carrier family 28 member 2, SPNT1CNT 2 |
|---|
| Gene, Accession # | SLC28A2, Gene ID: 9153, Accession: O43868, SwissProt: O43868 |
|---|
| Catalog # | NBP2-38763 |
|---|
| Price | |
|---|
| Order / More Info | SLC28A2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|