| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | TOR1AIP2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TOR1AIP2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TOR1AIP2. This antibody reacts with human. The TOR1AIP2 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human TOR1AIP2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: SDNSHCPDCGQQWFPSLELGHWLYQTELVENECYQVFLDRINRADYCPECYPDNPANRSLV |
|---|
| Other Names | FLJ77012, IFRG15, interferon responsive gene 15, LULL1MGC120077, lumenal domain like LAP1, Lumenal domain-like LAP1, MGC120074, MGC120075, MGC120076, MGC126581, MGC138430, NET9, RP11-12M5.5, torsin A interacting protein 2, torsin-1A-interacting protein 2 |
|---|
| Gene, Accession # | TOR1AIP2, Gene ID: 163590, Accession: Q9H496, SwissProt: Q9H496 |
|---|
| Catalog # | NBP2-34109 |
|---|
| Price | |
|---|
| Order / More Info | TOR1AIP2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|