| 产品详情 |
| Edit |   |
| Antigenic Specificity | TOR/mTOR |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The TOR/mTOR Antibody from Novus Biologicals is a rabbit polyclonal antibody to TOR/mTOR. This antibody reacts with human. The TOR/mTOR Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human TOR/mTOR antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: TESLDSTDYASRIIHPIVRTLDQSPELRSTAMDTLSSLVFQLGKKYQIFIPMVNKVLVRHRINHQRYDVLICRIVKGYTLADE |
| Other Names | EC 2.7.11.1, FK506 binding protein 12-rapamycin associated protein 1, FK506 binding protein 12-rapamycin associated protein 2, FK506-binding protein 12-rapamycin complex-associated protein 1, FKBP12-rapamycin complex-associated protein, FLJ44809, FRAP, FRAP1FKBP12-rapamycin complex-associated protein 1, FRAP2, Mammalian target of rapamycin, Mechanistic target of rapamycin, mechanistic target of rapamycin (serine/threonine kinase), mTOR, RAFT1, rapamycin and FKBP12 target 1, rapamycin associated protein FRAP2, Rapamycin target protein 1, RAPT1FKBP-rapamycin associated protein, serine/threonine-protein kinase mTOR |
| Gene, Accession # | MTOR, Gene ID: 2475 |
| Catalog # | NBP2-55920 |
| Price | |
| Order / More Info | TOR/mTOR Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|