| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | 6 Phosphofructo 2 Kinase |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The 6 Phosphofructo 2 Kinase Antibody from Novus Biologicals is a rabbit polyclonal antibody to 6 Phosphofructo 2 Kinase. This antibody reacts with human. The 6 Phosphofructo 2 Kinase Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human 6 Phosphofructo 2 Kinase antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: YLNVESVCTHRERSEDAKKGPNPLMRRNSVTPLASPEPTKKPRINSFEEHV |
|---|
| Other Names | 6PF-2-K/Fru-2,6-P2ase 3,6-bisphosphatase, 6-phosphofructo-2-kinase/ fructose-2,6-bisphosphatase, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 3,6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, FLJ37326, inducible 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, IPFK2, Renal carcinoma antigen NY-REN-56 |
|---|
| Gene, Accession # | PFKFB3, Gene ID: 5209 |
|---|
| Catalog # | NBP2-55403 |
|---|
| Price | |
|---|
| Order / More Info | 6 Phosphofructo 2 Kinase Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|