| Edit |   |
|---|
| Antigenic Specificity | Aminomethyltransferase |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Aminomethyltransferase Antibody from Novus Biologicals is a rabbit polyclonal antibody to Aminomethyltransferase. This antibody reacts with human. The Aminomethyltransferase Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to AMT(aminomethyltransferase) The peptide sequence was selected from the N terminal of AMT. Peptide sequence QRAVSVVARLGFRLQAFPPALCRPLSCAQEVLRRTPLYDFHLAHGGKMVA. |
|---|
| Other Names | aminomethyltransferase, EC 2.1.2.10, GCE, GCSTaminomethyltransferase (glycine cleavage system protein T), glycine cleavage system protein T, NKHmitochondrial |
|---|
| Gene, Accession # | AMT, Gene ID: 275, Accession: P48728, SwissProt: P48728 |
|---|
| Catalog # | NBP1-54766 |
|---|
| Price | |
|---|
| Order / More Info | Aminomethyltransferase Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|