| Edit |   |
| Antigenic Specificity | Protocadherin beta 13 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Protocadherin beta 13 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Protocadherin beta 13. This antibody reacts with human. The Protocadherin beta 13 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to PCDHB13(protocadherin beta 13) The peptide sequence was selected from the middle region of PCDHB13. Peptide sequence GKTFKINPLTGEIELKKQLDFEKLQSYEVNIEARDAGTFSGKCTVLIQVI. |
| Other Names | PCDH-beta-13, PCDH-BETA13, protocadherin beta 13, protocadherin beta-13 |
| Gene, Accession # | PCDHB13, Gene ID: 56123, Accession: Q9Y5F0, SwissProt: Q9Y5F0 |
| Catalog # | NBP1-59213-20ul |
| Price | |
| Order / More Info | Protocadherin beta 13 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |