| Edit |   |
|---|
| Antigenic Specificity | Lunatic Fringe |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Lunatic Fringe Antibody from Novus Biologicals is a rabbit polyclonal antibody to Lunatic Fringe. This antibody reacts with human. The Lunatic Fringe Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to LFNG(LFNG O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase) The peptide sequence was selected from the N terminal of LFNG. Peptide sequence LSEYFSLLTRARRDAGPPPGAAPRPADGHPRPLAEPLAPRDVFIAVKTTK. |
|---|
| Other Names | beta-1,3-N-acetylglucosaminyltransferase lunatic fringe, LFNG O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase, lunatic fringe (Drosophila) homolog, lunatic fringe homolog (Drosophila), O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase, SCDO3EC 2.4.1.222 |
|---|
| Gene, Accession # | LFNG, Gene ID: 3955, Accession: Q8NES3-3, SwissProt: Q8NES3-3 |
|---|
| Catalog # | NBP1-59432 |
|---|
| Price | |
|---|
| Order / More Info | Lunatic Fringe Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|