| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Lymphotoxin beta R/TNFRSF3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | Protein A purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Recommended conditions: Fixation/Permeabilization: PFA/Triton X-100 |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Lymphotoxin beta R/TNFRSF3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Lymphotoxin beta R/TNFRSF3. This antibody reacts with human. The Lymphotoxin beta R/TNFRSF3 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: EAELKDEVGKGNNHCVPCKAGHFQNTSSPSARCQPHTRCENQGLVEAAPGTAQSDTTCKNPLEPLPPEMSGT |
|---|
| Other Names | CD18, D12S370, ltbetar, LT-BETA-R, lymphotoxin B receptor, lymphotoxin beta receptor (TNFR superfamily, member 3), Lymphotoxin-beta receptor, TNFCRTNF-RIII, TNFR superfamily, member 3, TNFR2-RP, TNFR3, TNF-R-III, TNFR-RP, TNFRSF3TNFR-III, Tumor necrosis factor C receptor, Tumor necrosis factor receptor 2-related protein, tumor necrosis factor receptor superfamily member 3, tumor necrosis factor receptor superfamily, member 3, Tumor necrosis factor receptor type III |
|---|
| Gene, Accession # | LTBR, Gene ID: 4055 |
|---|
| Catalog # | NBP2-68777 |
|---|
| Price | |
|---|
| Order / More Info | Lymphotoxin beta R/TNFRSF3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|