| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | EN-RAGE/S100A12 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The EN-RAGE/S100A12 Antibody from Novus Biologicals is a rabbit polyclonal antibody to EN-RAGE/S100A12. This antibody reacts with human. The EN-RAGE/S100A12 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human EN-RAGE/S100A12 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: KLEEHLEGIVNIFHQYSVRKGHFDTLSKGELKQLLTKELANTIKNIKDKAVIDEIFQGLDANQDEQVDFQEFISLVAIALKAAHYHTHKE |
|---|
| Other Names | CAAF1Neutrophil S100 protein, CAGCS100 calcium binding protein A12 (calgranulin C), Calcium-binding protein in amniotic fluid 1, Calgranulin-C, CGRPEN-RAGE, ENRAGE, Extracellular newly identified RAGE-binding protein, MRP6, p6calgranulin C, protein S100-A12, S100 calcium binding protein A12, S100 calcium-binding protein A12, S100 calcium-binding protein A12 (calgranulin C) |
|---|
| Gene, Accession # | S100A12, Gene ID: 6283 |
|---|
| Catalog # | NBP1-86694 |
|---|
| Price | |
|---|
| Order / More Info | EN-RAGE/S100A12 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|