| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | NCOR1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The NCOR1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to NCOR1. This antibody reacts with human. The NCOR1 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human NCOR1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: PPTSTFQNSPSALVSTPVRTKTSNRYSPESQAQSVHHQRPGSRVSPENLVDKSRGSRPGKSPERSHVSSEPYEPISPPQVPVVHEKQDSLLLLSQ |
|---|
| Other Names | hN-CoR, KIAA1047N-CoR1, MGC104216, N-CoRhCIT529I10, nuclear receptor corepressor 1, nuclear receptor co-repressor 1, thyroid hormone- and retinoic acid receptor-associated corepressor 1, TRAC1 |
|---|
| Gene, Accession # | NCOR1, Gene ID: 9611 |
|---|
| Catalog # | NBP2-48997 |
|---|
| Price | |
|---|
| Order / More Info | NCOR1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|