| 产品详情 |
| Edit |   |
| Antigenic Specificity | MAP3K6 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The MAP3K6 Antibody from Novus Biologicals is a rabbit polyclonal antibody to MAP3K6. This antibody reacts with human. The MAP3K6 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human MAP3K6 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: EEPASPEESSGLSLLHQESKRRAMLAAVLEQELPALAENLHQEQKQEQGA RLGRNHVEELLRCLGAHIHTPNRR |
| Other Names | apoptosis signal regulating kinase 2, ASK2MGC20114, EC 2.7.11, EC 2.7.11.25, MAPKKK6MEKK6Apoptosis signal-regulating kinase 2, MGC125653, mitogen-activated protein kinase kinase kinase 6 |
| Gene, Accession # | MAP3K6, Gene ID: 9064 |
| Catalog # | NBP2-14219 |
| Price | |
| Order / More Info | MAP3K6 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|