| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | MAP4K2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The MAP4K2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to MAP4K2. This antibody reacts with human. The MAP4K2 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to MAP4K2(mitogen-activated protein kinase kinase kinase kinase 2) The peptide sequence was selected from the N terminal of MAP4K2. Peptide sequence TVTSELAAVKIVKLDPGDDISSLQQEITILRECRHPNVVAYIGSYLRNDR. |
|---|
| Other Names | B lymphocyte serine/threonine protein kinase, B lymphocyte serine/threonine-protein kinase, BL44, EC 2.7.11, EC 2.7.11.1, GC kinase, GCKMEK kinase kinase 2, Germinal center kinase, germinal centre kinase (GC kinase), MAPK/ERK kinase kinase kinase 2, mitogen-activated protein kinase kinase kinase kinase 2, Rab8 interacting protein, Rab8-interacting protein, RAB8IPMEKKK 2 |
|---|
| Gene, Accession # | MAP4K2, Gene ID: 5871, Accession: Q12851, SwissProt: Q12851 |
|---|
| Catalog # | NBP1-58851 |
|---|
| Price | |
|---|
| Order / More Info | MAP4K2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|