| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | MAP4K3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The MAP4K3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to MAP4K3. This antibody reacts with human. The MAP4K3 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human MAP4K3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: HSTEDENQGTIKRCPMSGSPAKPSQVPPRPPPPRLPPHKPVALGNGMSSFQLNGERDGSLCQQQNEHRGTNLSRKEKKDVP |
|---|
| Other Names | EC 2.7.11, EC 2.7.11.1, germinal center kinase-like kinase, Germinal center kinase-related protein kinase, GLKMEKKK 3, MAPK/ERK kinase kinase kinase 3, MAPKKKK3, MEK kinase kinase 3, mitogen-activated protein kinase kinase kinase kinase 3, RAB8IPL1 |
|---|
| Gene, Accession # | MAP4K3, Gene ID: 8491 |
|---|
| Catalog # | NBP1-81824 |
|---|
| Price | |
|---|
| Order / More Info | MAP4K3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|