| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | MAP4K6 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The MAP4K6 Antibody from Novus Biologicals is a rabbit polyclonal antibody to MAP4K6. This antibody reacts with human. The MAP4K6 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human MAP4K6 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: ARPRSNSAWQIYLQRRAERGTPKPPGPPAQPPGPPNASSNPDLRRSDPGWERSDSVLPASHGHL |
|---|
| Other Names | B55, EC 2.7.11, GCK family kinase MiNK, hMINK, hMINKbeta, MAP4K6EC 2.7.11.1, MAPK/ERK kinase kinase kinase 6, MEK kinase kinase 6, MGC21111, MINKMEKKK 6, Misshapen/NIK-related kinase, misshapen-like kinase 1, misshapen-like kinase 1 (zebrafish), Mitogen-activated protein kinase kinase kinase kinase 6, serine/threonine protein kinase, YSK2, ZC3 |
|---|
| Gene, Accession # | MINK1, Gene ID: 50488 |
|---|
| Catalog # | NBP2-49220 |
|---|
| Price | |
|---|
| Order / More Info | MAP4K6 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|