| 产品详情 |
| Edit |   |
| Antigenic Specificity | MAPKAPK2 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The MAPKAPK2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to MAPKAPK2. This antibody reacts with human. The MAPKAPK2 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human MAPKAPK2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: QIFNKRTQEKFALKMLQDCPKARREVELHWRASQCPHIVRIVDVYENLYAG |
| Other Names | EC 2.7.11, EC 2.7.11.1, MAP kinase-activated protein kinase 2, MAPK-activated protein kinase 2, MAPKAP kinase 2, MAPKAPK-2, mitogen-activated protein kinase-activated protein kinase 2, MK2 |
| Gene, Accession # | MAPKAPK2, Gene ID: 9261 |
| Catalog # | NBP2-56233 |
| Price | |
| Order / More Info | MAPKAPK2 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|