| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | RDH14 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The RDH14 Antibody from Novus Biologicals is a rabbit polyclonal antibody to RDH14. This antibody reacts with human. The RDH14 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human RDH14 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: QTSIYLASSPEVEGVSGRYFGDCKEEELLPKAMDESVARKLWDISEVMVGL |
|---|
| Other Names | Alcohol dehydrogenase PAN2, EC 1.1.1.-, PAN2retinol dehydrogenase 14, pancreas protein 2, retinol dehydrogenase 14 (all-trans and 9-cis), retinol dehydrogenase 14 (all-trans/9-cis/11-cis), SDR7C4, short chain dehydrogenase/reductase family 7C, member 4 |
|---|
| Gene, Accession # | RDH14, Gene ID: 57665, Accession: Q9HBH5, SwissProt: Q9HBH5 |
|---|
| Catalog # | NBP2-31647 |
|---|
| Price | |
|---|
| Order / More Info | RDH14 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|