| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | RDH16 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The RDH16 Antibody from Novus Biologicals is a rabbit polyclonal antibody to RDH16. This antibody reacts with human. The RDH16 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human RDH16 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: GVKVAMIEPGYFKTAVTSKERFLKSFLEIWDRSSPEVKEAYGEKFVADYKKSAEQMEQKCTQDLSLVT |
|---|
| Other Names | EC 1.1, EC 1.1.1, EC 1.1.1.105, Microsomal NAD+-dependent retinol dehydrogenase 4, retinol dehydrogenase 16, retinol dehydrogenase 16 (all-trans and 13-cis), retinol dehydrogenase 16 (all-trans), RoDH-4, RODH4, SDR9C8, short chain dehydrogenase/reductase family 9C, member 8, Sterol/retinol dehydrogenase |
|---|
| Gene, Accession # | RDH16, Gene ID: 8608, Accession: O75452, SwissProt: O75452 |
|---|
| Catalog # | NBP1-87117 |
|---|
| Price | |
|---|
| Order / More Info | RDH16 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 24648543 |
|---|
| 产品资料 |
|
|