| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | RDH5 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The RDH5 Antibody from Novus Biologicals is a rabbit polyclonal antibody to RDH5. This antibody reacts with human. The RDH5 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human RDH5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: NNAGVAGIIGPTPWLTRDDFQRVLNVNTMGPIGVTLALL |
|---|
| Other Names | 11-cis RDH, 11-cis retinol dehydrogenase, 9,9-cis-retinol specific dehydrogenase, EC 1.1.1, EC 1.1.1.105, FLJ39337, FLJ97089, HSD17B, RDH1, retinol dehydrogenase 1, retinol dehydrogenase 5 (11-cis and 9-cis), retinol dehydrogenase 5 (11-cis/9-cis), SDR9C5, short chain dehydrogenase/reductase family 9C, member 5 |
|---|
| Gene, Accession # | RDH5, Gene ID: 5959 |
|---|
| Catalog # | NBP2-56636 |
|---|
| Price | |
|---|
| Order / More Info | RDH5 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|