| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ENO3 |
|---|
| Clone | 5D1 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human, bovine |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, RNA Inhibition. Antibody reactivity against recominant protein and cell lysate for WB. It has been used for IF, IHC-P, RNAi Validation and ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ENO3 Antibody (5D1) from Novus Biologicals is a mouse monoclonal antibody to ENO3. This antibody reacts with human, bovine. The ENO3 Antibody (5D1) has been validated for the following applications: Western Blot, ELISA, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, RNA Inhibition. |
|---|
| Immunogen | ENO3 (NP_001967 228 a.a. - 277 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KTAIQAAGYPDKVVIGMDVAASEFYRNGKYDLDFKSPDDPARHITGEKLG |
|---|
| Other Names | 2-phospho-D-glycerate hydrolyase, 2-phospho-D-glycerate hydro-lyase, beta-enolase, EC 4.2.1, EC 4.2.1.11, Enolase 3, enolase 3 (beta, muscle), enolase 3, (beta, muscle), GSD13, MSE, Muscle-specific enolase, Skeletal muscle enolase |
|---|
| Gene, Accession # | ENO3, Gene ID: 2027, Accession: NP_001967, SwissProt: NP_001967 |
|---|
| Catalog # | H00002027-M01 |
|---|
| Price | |
|---|
| Order / More Info | ENO3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 17020980, 21569246, 21855665, 22444818, 22848045, 25175407, 26344128, 26369674, 28039026 |
|---|
| 产品资料 |
|
|