| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | NOL1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunoprecipitation, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The NOL1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to NOL1. This antibody reacts with human, mouse, rat. The NOL1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunoprecipitation, Immunohistochemistry-Paraffin. Specificity of human, mouse, rat NOL1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: KLMDLFPLSELVEFLEANEVPRPVTLRTNTLKTRRRDLAQALINRGVNLDPLGKWSKTGLVVYDSSVPIGATPEYLAGH |
|---|
| Other Names | EC 2.1.1, EC 2.1.1.-, MGC149287, MGC149288, NOL1/NOP2/Sun domain family, member 1, NOL1MGC117384, NOP120, NOP2 nucleolar protein homolog (yeast), NOP2/Sun domain family, member 1, NSUN1, Nucleolar protein 1, nucleolar protein 1 (120kD), nucleolar protein 1, 120kDa, Nucleolar protein 2 homolog, nucleolar protein 2 homolog (yeast), p120, Proliferating-cell nucleolar antigen p120, Proliferation-associated nucleolar protein p120, putative ribosomal RNA methyltransferase NOP2 |
|---|
| Gene, Accession # | NOP2, Gene ID: 4839, Accession: P46087, SwissProt: P46087 |
|---|
| Catalog # | NBP1-92192 |
|---|
| Price | |
|---|
| Order / More Info | NOL1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 26906424, 27376061 |
|---|
| 产品资料 |
|
|