| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | beta-Galactosidase-1/GLB1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The beta-Galactosidase-1/GLB1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to beta-Galactosidase-1/GLB1. This antibody reacts with human. The beta-Galactosidase-1/GLB1 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human beta-Galactosidase-1/GLB1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: GRYWPARGPQLTLFVPQHILMTSAPNTITVLELEWAPCSSDDPELCAVTFVDRPVIGSSVTYDHPSKPVEKRLMPPPPQKNKDSWLDHV |
|---|
| Other Names | Acid beta-galactosidase, beta-galactosidase, EBP, EC 3.2.1.23, Elastin receptor 1, elastin receptor 1 (67kD), elastin receptor 1, 67kDa, ELNR1, galactosidase, beta 1, Lactase, MPS4B |
|---|
| Gene, Accession # | GLB1, Gene ID: 2720 |
|---|
| Catalog # | NBP2-57793 |
|---|
| Price | |
|---|
| Order / More Info | beta-Galactosidase-1/GLB1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|