| 产品详情 |
| Edit |   |
| Antigenic Specificity | MAT2B |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The MAT2B Antibody from Novus Biologicals is a rabbit polyclonal antibody to MAT2B. This antibody reacts with human. The MAT2B Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human MAT2B antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: AVGAFLIYISSDYVFDGTNPPYREEDIPAPLNLYGKTKLDGEKAVLENNLGAAVLRIPILYGEVEKLEESAVTVM |
| Other Names | beta regulatory subunit of methionine adenosyltransferase, DTDP-4-keto-6-deoxy-D-glucose 4-reductase, MAT II beta, MAT-II, MATIIbeta, methionine adenosyltransferase 2 subunit beta, Methionine adenosyltransferase II beta, methionine adenosyltransferase II, beta, MGC12237, Nbla02999, putative protein product of Nbla02999, SDR23E1, short chain dehydrogenase/reductase family 23E, member 1, TGR |
| Gene, Accession # | MAT2B, Gene ID: 27430 |
| Catalog # | NBP1-82798 |
| Price | |
| Order / More Info | MAT2B Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|