| 产品详情 |
| Edit |   |
| Antigenic Specificity | MATK |
| Clone | 2C5 |
| Host Species | Mouse |
| Reactive Species | human |
| Isotype | IgG2a kappa |
| Format | IgG purified, no preservative |
| Size | 0.05 mg |
| Concentration | n/a |
| Applications | Western Blot, ELISA. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The MATK Antibody (2C5) from Novus Biologicals is a mouse monoclonal antibody to MATK. This antibody reacts with human. The MATK Antibody (2C5) has been validated for the following applications: Western Blot, ELISA. |
| Immunogen | MATK (NP_647612 422 a.a. - 507 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RAPYPKMSLKEVSEAVEKGYRMEPPEGCPGPVHVLMSSCWEAEPARRPPFRKLAEKLARELRSAGAPASVSGQDADGSTSPRSQEP |
| Other Names | CHK, Csk-type protein tyrosine kinase, CTKEC 2.7.10.2, DKFZp434N1212, EC 2.7.10, Hematopoietic consensus tyrosine-lacking kinase, HHYLTK, hydroxyaryl-protein kinase, HYL tyrosine kinase, HYLCsk-homologous kinase, HYLTK, leukocyte carboxyl-terminal src kinase related, Lsk, megakaryocyte-associated tyrosine kinase, megakaryocyte-associated tyrosine-protein kinase, MGC1708, MGC2101, Protein kinase HYL, tyrosine kinase MATK, Tyrosine-protein kinase CTK, tyrosylprotein kinase |
| Gene, Accession # | MATK, Gene ID: 4145, Accession: NP_647612, SwissProt: NP_647612 |
| Catalog # | H00004145-M05 |
| Price | |
| Order / More Info | MATK Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|